PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G219200.1.p
Common NameSb01g019270, SORBIDRAFT_01g019270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 297aa    MW: 32541.2 Da    PI: 4.8448
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G219200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+W++eEd++lv +++q G ++W++ +r  g+ R++k+c++rw +yl
  Sobic.001G219200.1.p 14 RGAWSPEEDQRLVAYIQQNGHPNWRALPRQAGLLRCGKSCRLRWINYL 61
                          89******************************99************97 PP

2Myb_DNA-binding49.31.2e-1567111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg+++++E+ l+v+++++lG++ W++Ia+ ++ gRt++++k+ w+++
  Sobic.001G219200.1.p  67 RGNFSADEEALIVRLHRELGNR-WSAIAAQLP-GRTDNEIKNVWHTH 111
                           89********************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.615961IPR017930Myb domain
SuperFamilySSF466893.55E-2811108IPR009057Homeodomain-like
SMARTSM007173.2E-121363IPR001005SANT/Myb domain
PfamPF002495.3E-151461IPR001005SANT/Myb domain
CDDcd001679.26E-101661No hitNo description
PROSITE profilePS5129424.58862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2565116IPR009057Homeodomain-like
SMARTSM007171.0E-1366114IPR001005SANT/Myb domain
PfamPF002492.9E-1467111IPR001005SANT/Myb domain
CDDcd001673.54E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRAPCCEKE GLRRGAWSPE EDQRLVAYIQ QNGHPNWRAL PRQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SADEEALIVR LHRELGNRWS AIAAQLPGRT DNEIKNVWHT HIKKRLEDGD  120
DGEDKKKAAR KSKPAAAAKR SSAAKKTADA NAVDNNSEQQ QPFLTASPGL SSSVSSGVTT  180
FSTATDSAAA VSSADNAATT SHQQEQEQEQ EQEQLGASKA EMDMEMESFI SSAEFPPIDD  240
TFWSSADVMD MGLGAMDEEL GLALAGPPSS STRDEDMEFW LKMLLEAGDM RDLSVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794080.0HF679408.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB2 protein.
GenBankJQ2554780.0JQ255478.1 Saccharum hybrid cultivar Co 86032 MYB46 (MYB46) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464484.10.0hypothetical protein SORBIDRAFT_01g019270
TrEMBLC5WYF10.0C5WYF1_SORBI; Putative uncharacterized protein Sb01g019270
STRINGSb01g019270.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-65myb domain protein 15
Publications ? help Back to Top
  1. H
    The R2R3-MYB transcription factors MYB14 and MYB15 regulate stilbene biosynthesis in Vitis vinifera.
    Plant Cell, 2013. 25(10): p. 4135-49
    [PMID:24151295]